PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_019052-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 98aa    MW: 11240.9 Da    PI: 9.9498
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_019052-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.91.4e-191562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv ++k++G g+W++ ++  g++R++k+c++rw +yl
  AHYPO_019052-RA 15 KGPWTQEEDEKLVSYIKKHGLGSWRALPKAAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-25765IPR009057Homeodomain-like
PROSITE profilePS5129425.2371066IPR017930Myb domain
SMARTSM007171.8E-151464IPR001005SANT/Myb domain
PfamPF002498.0E-181562IPR001005SANT/Myb domain
SuperFamilySSF466895.58E-231688IPR009057Homeodomain-like
CDDcd001671.75E-111762No hitNo description
Gene3DG3DSA:1.10.10.601.1E-66687IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MGRSPCCDDN IELKKGPWTQ EEDEKLVSYI KKHGLGSWRA LPKAAGLNRC GKSCRLRWTN  60
YLRPDIKRGH FNEQEEDMII KLHSVVKNCS PSSRKNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-161288479B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010695546.12e-50PREDICTED: transcription factor MYB39
SwissprotQ9SZP13e-40MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A0J8B8I52e-50A0A0J8B8I5_BETVU; Uncharacterized protein
TrEMBLA0A0K9R2G51e-50A0A0K9R2G5_SPIOL; Uncharacterized protein
STRINGAT5G16770.14e-44(Arabidopsis thaliana)
STRINGfgenesh2_kg.6__1669__AT5G16770.15e-44(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-47myb domain protein 9